Lineage for d4lpaa_ (4lpa A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920163Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 1920164Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 1920165Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 1920192Protein automated matches [227065] (3 species)
    not a true protein
  7. 1920196Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228797] (1 PDB entry)
  8. 1920197Domain d4lpaa_: 4lpa A: [235499]
    automated match to d4lpad_

Details for d4lpaa_

PDB Entry: 4lpa (more details), 2.9 Å

PDB Description: crystal structure of a cdc6 phosphopeptide in complex with cks1
PDB Compounds: (A:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d4lpaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lpaa_ d.97.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechapephillfkrplnyeaelraaipitpt

SCOPe Domain Coordinates for d4lpaa_:

Click to download the PDB-style file with coordinates for d4lpaa_.
(The format of our PDB-style files is described here.)

Timeline for d4lpaa_: