Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
Protein automated matches [227065] (2 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [228797] (1 PDB entry) |
Domain d4lpaa_: 4lpa A: [235499] automated match to d4lpad_ |
PDB Entry: 4lpa (more details), 2.9 Å
SCOPe Domain Sequences for d4lpaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpaa_ d.97.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl riltedewrglgitqslgwehyechapephillfkrplnyeaelraaipitpt
Timeline for d4lpaa_: