SCOPe 2.08: Domain d4lnoe1: 4lno E:2-104

Lineage for d4lnoe1 (4lno E:2-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)

8. Domain d4lnoe1: 4lno E:2-104 [235497]
   Other proteins in same PDB: d4lnoa2, d4lnob2, d4lnoc2, d4lnod2, d4lnoe2, d4lnof2
   automated match to d4lnkc1
   complexed with gln, mg

Details for d4lnoe1

PDB Entry: 4lno, 2.9 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: form two of GS-1

PDB Compounds: (E:) glutamine synthetase

SCOPe Domain Sequences for d4lnoe1:

Sequence; same for both SEQRES and ATOM records:

>d4lnoe1 d.15.9.0 (E:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

Timeline for d4lnoe1:

• d4lnoe1 first appeared in SCOPe 2.03
  
• d4lnoe1 appears in SCOPe 2.07