Lineage for d4lnof2 (4lno F:105-444)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2975032Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2975033Protein automated matches [227028] (6 species)
    not a true protein
  7. 2975034Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)
  8. 2975040Domain d4lnof2: 4lno F:105-444 [235496]
    Other proteins in same PDB: d4lnoa1, d4lnob1, d4lnoc1, d4lnod1, d4lnoe1, d4lnof1
    automated match to d4lnkc2
    complexed with gln, mg

Details for d4lnof2

PDB Entry: 4lno (more details), 2.9 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: form two of GS-1
PDB Compounds: (F:) glutamine synthetase

SCOPe Domain Sequences for d4lnof2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnof2 d.128.1.0 (F:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

SCOPe Domain Coordinates for d4lnof2:

Click to download the PDB-style file with coordinates for d4lnof2.
(The format of our PDB-style files is described here.)

Timeline for d4lnof2: