Lineage for d4lfnd_ (4lfn D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1630447Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 1630448Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 1630500Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 1630501Protein automated matches [191196] (7 species)
    not a true protein
  7. 1630520Species Lactobacillus rhamnosus [TaxId:568704] [229308] (4 PDB entries)
  8. 1630532Domain d4lfnd_: 4lfn D: [235365]
    automated match to d4lfmd_
    complexed with rbl

Details for d4lfnd_

PDB Entry: 4lfn (more details), 1.65 Å

PDB Description: crystal structure of d-galactose-6-phosphate isomerase in complex with d-ribulose
PDB Compounds: (D:) Galactose-6-phosphate isomerase subunit B

SCOPe Domain Sequences for d4lfnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lfnd_ c.121.1.0 (D:) automated matches {Lactobacillus rhamnosus [TaxId: 568704]}
miiaigndhivtmqkieisnmlkdmgytvidegtydthrthypiygkkvaedvadgradl
givmcgtgigistaadknegiraamcddvtsavyareqlnanvlgiggavvgvhliqdiv
kayldatyketpenkklidkidniakpnpdqkdnphffdaelekwaegvyhd

SCOPe Domain Coordinates for d4lfnd_:

Click to download the PDB-style file with coordinates for d4lfnd_.
(The format of our PDB-style files is described here.)

Timeline for d4lfnd_: