SCOPe 2.05: Domain d4l75a2: 4l75 A:245-339

Lineage for d4l75a2 (4l75 A:245-339)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.0: automated matches [228502] (1 protein)
   not a true family

6. Protein automated matches [228504] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)

8. Domain d4l75a2: 4l75 A:245-339 [235291]
   Other proteins in same PDB: d4l75a1, d4l75b1, d4l75c1, d4l75d1, d4l75e1, d4l75f1
   automated match to d4l75d2
   complexed with ca; mutant

Details for d4l75a2

PDB Entry: 4l75, 2.39 Å

PDB Description: ca2+-bound d184n mutant mthk rck domain at 2.4 angstrom

PDB Compounds: (A:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l75a2:

Sequence; same for both SEQRES and ATOM records:

>d4l75a2 d.286.1.0 (A:245-339) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisalvp

Timeline for d4l75a2:

• d4l75a2 first appeared in SCOPe 2.03
  
• d4l75a2 appears in SCOPe 2.04
  
• d4l75a2 appears in SCOPe 2.06
  
• d4l75a2 appears in the current release, SCOPe 2.08