Lineage for d4l73b2 (4l73 B:245-336)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947194Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 1947195Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 1947226Family d.286.1.0: automated matches [228502] (1 protein)
    not a true family
  6. 1947227Protein automated matches [228504] (1 species)
    not a true protein
  7. 1947228Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)
  8. 1947240Domain d4l73b2: 4l73 B:245-336 [235287]
    Other proteins in same PDB: d4l73a1, d4l73b1
    automated match to d4l74a2
    complexed with ca, cl, na

Details for d4l73b2

PDB Entry: 4l73 (more details), 2.5 Å

PDB Description: Ca2+-bound MthK RCK domain at 2.5 Angstrom
PDB Compounds: (B:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4l73b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l73b2 d.286.1.0 (B:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOPe Domain Coordinates for d4l73b2:

Click to download the PDB-style file with coordinates for d4l73b2.
(The format of our PDB-style files is described here.)

Timeline for d4l73b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l73b1