Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) |
Family d.286.1.0: automated matches [228502] (1 protein) not a true family |
Protein automated matches [228504] (1 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries) |
Domain d4l73b2: 4l73 B:245-336 [235287] Other proteins in same PDB: d4l73a1, d4l73b1 automated match to d4l74a2 complexed with ca, cl, na |
PDB Entry: 4l73 (more details), 2.5 Å
SCOPe Domain Sequences for d4l73b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l73b2 d.286.1.0 (B:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisa
Timeline for d4l73b2: