Lineage for d1c8m1_ (1c8m 1:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107303Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 107304Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 107416Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 107576Protein Rhinovirus coat protein [49670] (5 species)
  7. 107659Species Human rhinovirus 16 [TaxId:31708] [49672] (6 PDB entries)
  8. 107675Domain d1c8m1_: 1c8m 1: [23528]

Details for d1c8m1_

PDB Entry: 1c8m (more details), 2.8 Å

PDB Description: refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials

SCOP Domain Sequences for d1c8m1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8m1_ b.10.1.4 (1:) Rhinovirus coat protein {Human rhinovirus 16}
npveryvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq
tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds
eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs
lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka
khtkawcprppravqyshthttnyklssevhndvairprtnlttv

SCOP Domain Coordinates for d1c8m1_:

Click to download the PDB-style file with coordinates for d1c8m1_.
(The format of our PDB-style files is described here.)

Timeline for d1c8m1_: