Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196777] (34 PDB entries) |
Domain d4kqob2: 4kqo B:222-563 [235208] Other proteins in same PDB: d4kqoa1, d4kqob1 automated match to d4kqoa2 complexed with cl, gol, imd, jpp |
PDB Entry: 4kqo (more details), 2.31 Å
SCOPe Domain Sequences for d4kqob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kqob2 e.3.1.0 (B:222-563) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} sidlrlqylahrelrnallengakagslvimdvktgeilamtnqptynpnnrrnlqpaam rnramidvfepgstvkpfsmsaalasgrwkpsdivdvypgtlqigrytirdvsrnsrqld ltgilikssnvgiskiafdigaesiysvmqqvglgqdtglgfpgervgnlpnhrkwpkae tatlaygyglsvtaiqlahayaalandgksvplsmtrvdrvpdgvqvispevastvqgml qqvveaqggvfraqvpgyhaagksgtarkvsvgtkgyrenayrslfagfapatdpriamv vvidepskagyfgglvsapvfskvmagalrlmnvppdnlpta
Timeline for d4kqob2: