Lineage for d4kooc1 (4koo C:78-241)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937473Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2937474Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2937490Family d.18.1.2: Plant transcriptional regulator PBF-2 [75375] (2 proteins)
    single-chain domain formed by a tandem repeat of two motifs
  6. 2937497Protein automated matches [228955] (1 species)
    not a true protein
  7. 2937498Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [228956] (2 PDB entries)
  8. 2937502Domain d4kooc1: 4koo C:78-241 [235204]
    Other proteins in same PDB: d4kooa2, d4kooc2, d4kood2
    automated match to d4kood_
    complexed with mes, ni, po4

Details for d4kooc1

PDB Entry: 4koo (more details), 1.88 Å

PDB Description: crystal structure of why1 from arabidopsis thaliana
PDB Compounds: (C:) Single-stranded DNA-binding protein WHY1, chloroplastic

SCOPe Domain Sequences for d4kooc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kooc1 d.18.1.2 (C:78-241) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
parfyvghsiykgkaaltvdprapefvaldsgafklskdgflllqfapsagvrqydwskk
qvfslsvteigtlvslgpresceffhdpfkgksdegkvrkvlkveplpdgsghffnlsvq
nklvnvdesiyipitraefavlisafnfvlpyligwhafansik

SCOPe Domain Coordinates for d4kooc1:

Click to download the PDB-style file with coordinates for d4kooc1.
(The format of our PDB-style files is described here.)

Timeline for d4kooc1: