Lineage for d4kf1d_ (4kf1 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2442705Protein automated matches [190150] (34 species)
    not a true protein
  7. 2442939Species Sulfolobus solfataricus [TaxId:2287] [188418] (16 PDB entries)
  8. 2442953Domain d4kf1d_: 4kf1 D: [235160]
    automated match to d4ketd_
    complexed with co, edo, fe2, gol, ht5, pg4

Details for d4kf1d_

PDB Entry: 4kf1 (more details), 2 Å

PDB Description: crystal structure of ssopox w263i in complex with c10htl
PDB Compounds: (D:) aryldialkylphosphatase

SCOPe Domain Sequences for d4kf1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kf1d_ c.1.9.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidigtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

SCOPe Domain Coordinates for d4kf1d_:

Click to download the PDB-style file with coordinates for d4kf1d_.
(The format of our PDB-style files is described here.)

Timeline for d4kf1d_: