Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d4k3xa_: 4k3x A: [235093] Other proteins in same PDB: d4k3xb1, d4k3xb2, d4k3xd1, d4k3xd2, d4k3xf1, d4k3xf2 automated match to d4k3xe_ complexed with nag, p4g |
PDB Entry: 4k3x (more details), 2.15 Å
SCOPe Domain Sequences for d4k3xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k3xa_ b.19.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]} dqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpaw lmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidmt rfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqts naaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsiv stgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaigd cpkyvkaqelvlatglrnnpik
Timeline for d4k3xa_: