Lineage for d4k3xa_ (4k3x A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776681Domain d4k3xa_: 4k3x A: [235093]
    Other proteins in same PDB: d4k3xb1, d4k3xb2, d4k3xd1, d4k3xd2, d4k3xf1, d4k3xf2
    automated match to d4k3xe_
    complexed with nag, p4g

Details for d4k3xa_

PDB Entry: 4k3x (more details), 2.15 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4k3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3xa_ b.19.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpaw
lmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidmt
rfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqts
naaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsiv
stgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaigd
cpkyvkaqelvlatglrnnpik

SCOPe Domain Coordinates for d4k3xa_:

Click to download the PDB-style file with coordinates for d4k3xa_.
(The format of our PDB-style files is described here.)

Timeline for d4k3xa_: