Lineage for d4k3xd1 (4k3x D:6-174)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041679Domain d4k3xd1: 4k3x D:6-174 [240377]
    Other proteins in same PDB: d4k3xa_, d4k3xb2, d4k3xc_, d4k3xd2, d4k3xe_, d4k3xf2
    automated match to d4n5zb_
    complexed with nag, p4g

Details for d4k3xd1

PDB Entry: 4k3x (more details), 2.15 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4k3xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3xd1 h.3.1.1 (D:6-174) automated matches {Influenza A virus, different strains [TaxId: 11320]}
iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkid

SCOPe Domain Coordinates for d4k3xd1:

Click to download the PDB-style file with coordinates for d4k3xd1.
(The format of our PDB-style files is described here.)

Timeline for d4k3xd1: