Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (16 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries) |
Domain d4k1xb1: 4k1x B:16-113 [235077] Other proteins in same PDB: d4k1xa2, d4k1xb2 automated match to d4k1xa1 complexed with fad, so4; mutant |
PDB Entry: 4k1x (more details), 1.7 Å
SCOPe Domain Sequences for d4k1xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k1xb1 b.43.4.0 (B:16-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]} pdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspawde elefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv
Timeline for d4k1xb1: