SCOPe 2.07: Domain d4jh6b_: 4jh6 B:

Lineage for d4jh6b_ (4jh6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Bacillus cereus [TaxId:222523] [228045] (9 PDB entries)

8. Domain d4jh6b_: 4jh6 B: [235000]
   automated match to d4jh2a_
   complexed with fcn, gol, mg, mn

Details for d4jh6b_

PDB Entry: 4jh6, 1.32 Å

PDB Description: Crystal Structure of FosB from Bacillus cereus with Manganese and Fosfomycin

PDB Compounds: (B:) Metallothiol transferase FosB

SCOPe Domain Sequences for d4jh6b_:

Sequence; same for both SEQRES and ATOM records:

>d4jh6b_ d.32.1.0 (B:) automated matches {Bacillus cereus [TaxId: 222523]}
mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
lqdrlnyyredkphmtfy

Timeline for d4jh6b_:

• d4jh6b_ first appeared in SCOPe 2.03
  
• d4jh6b_ appears in SCOPe 2.06
  
• d4jh6b_ appears in the current release, SCOPe 2.08