Lineage for d4j7bb1 (4j7b B:363-491)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613471Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2613472Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2613484Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 2613485Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 2613567Species Zebrafish (Danio rerio) [TaxId:7955] [234931] (1 PDB entry)
  8. 2613568Domain d4j7bb1: 4j7b B:363-491 [234932]
    Other proteins in same PDB: d4j7ba_, d4j7bd_
    automated match to d1q4ka1

Details for d4j7bb1

PDB Entry: 4j7b (more details), 2.3 Å

PDB Description: crystal structure of polo-like kinase 1
PDB Compounds: (B:) Polo-like kinase

SCOPe Domain Sequences for d4j7bb1:

Sequence, based on SEQRES records: (download)

>d4j7bb1 d.223.1.2 (B:363-491) Serine/threonine-protein kinase plk C-terminal domain {Zebrafish (Danio rerio) [TaxId: 7955]}
thltdmlqqlavvnaakpsdrgfirqeeaedpacipvfwiskwvdysdkyglgyqlsdns
vgvlfndstrlimcadgdslqyidrnslesylsvrsypsalskkitllkyfrnymsehll
kaganitpr

Sequence, based on observed residues (ATOM records): (download)

>d4j7bb1 d.223.1.2 (B:363-491) Serine/threonine-protein kinase plk C-terminal domain {Zebrafish (Danio rerio) [TaxId: 7955]}
thltdmlqqlavvnaakpsdrgfirqeeaedpacipvfwiskwvdysdkyglgyqlsdns
vgvlfndstrlimcadgdslqyidrnslesylsvrsypsalskkitllkyfrnymsepr

SCOPe Domain Coordinates for d4j7bb1:

Click to download the PDB-style file with coordinates for d4j7bb1.
(The format of our PDB-style files is described here.)

Timeline for d4j7bb1: