Lineage for d4i3va_ (4i3v A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516430Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2516431Protein automated matches [190683] (59 species)
    not a true protein
  7. 2517240Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)
  8. 2517277Domain d4i3va_: 4i3v A: [234784]
    automated match to d4i3ve_
    complexed with nad, poa

Details for d4i3va_

PDB Entry: 4i3v (more details), 2 Å

PDB Description: structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetaldehyde and cofactor nad+
PDB Compounds: (A:) Aldehyde dehydrogenase (NAD+)

SCOPe Domain Sequences for d4i3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i3va_ c.82.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
hepmriagrlvdtddrvevrypwndtvvgtvpagraehareafaiaaayqpkltryerqk
illataealaarkeeisdvitlelgiskadslyevgrafdvftlagqmcirddgeifscd
ltphgkarkiftmrepltaisaitpfnhplnmvahkvapaiatnncvvvkpteltpmtal
lladilyeaglppemlsvvtgwpadigmemitnphvdlvtftgsvpvgkliaanahykrq
vlelggndpliilndlsdddlaraadlavagatknsgqrctavkrilcqesvadrfvplv
lerakrlrfgdpmdrstdlgtvihekaaalfeervmraaeegadilyhpgrsgallppiv
vdrvphqsdlvleetfgpiipivrvpddddatitlsnstafglssgvctndyrrmqkyia
glkvgtvniwevpgyriemspfggikdsgngykegvieamksftnvktfslpw

SCOPe Domain Coordinates for d4i3va_:

Click to download the PDB-style file with coordinates for d4i3va_.
(The format of our PDB-style files is described here.)

Timeline for d4i3va_: