Lineage for d4hyrb1 (4hyr B:2-133)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (87 species)
    not a true protein
  7. 2171208Species Acidaminococcus sp. [TaxId:563191] [234733] (1 PDB entry)
  8. 2171210Domain d4hyrb1: 4hyr B:2-133 [234737]
    Other proteins in same PDB: d4hyra2, d4hyra3, d4hyrb2, d4hyrb3
    automated match to d4g8ta1
    complexed with cl, edo, gol

Details for d4hyrb1

PDB Entry: 4hyr (more details), 1.84 Å

PDB Description: structure of putative glucarate dehydratase from acidaminococcus sp. d21 with unusual static disorder
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4hyrb1:

Sequence, based on SEQRES records: (download)

>d4hyrb1 d.54.1.0 (B:2-133) automated matches {Acidaminococcus sp. [TaxId: 563191]}
vpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkittale
nvsdivvgtkvsdyrntllkvqaeldksgekdergaqtfdlrtgvhvltaieapcldllg
kaldmpvcrllg

Sequence, based on observed residues (ATOM records): (download)

>d4hyrb1 d.54.1.0 (B:2-133) automated matches {Acidaminococcus sp. [TaxId: 563191]}
vpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkittale
nvsdivvgtkvsdyrntllkvqaeldksdlrtgvhvltaieapcldllgkaldmpvcrll
g

SCOPe Domain Coordinates for d4hyrb1:

Click to download the PDB-style file with coordinates for d4hyrb1.
(The format of our PDB-style files is described here.)

Timeline for d4hyrb1: