| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein automated matches [190091] (20 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries) |
| Domain d4hokm_: 4hok M: [234693] automated match to d4hokw_ complexed with so4 |
PDB Entry: 4hok (more details), 2.77 Å
SCOPe Domain Sequences for d4hokm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hokm_ d.144.1.7 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvgnkyrlgrkigsgsfgdiylganiasgeevaiklecvktkhpqlhieskfykmmqggv
gipsikwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihskn
fihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasin
thlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckg
ypsefstylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
Timeline for d4hokm_: