SCOPe 2.07: Domain d4ho4b1: 4ho4 B:1-296

Lineage for d4ho4b1 (4ho4 B:1-296)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
   automatically mapped to Pfam PF00483

6. Protein RmlA (RfbA) [53465] (5 species)

7. Species Aneurinibacillus thermoaerophilus [TaxId:143495] [228438] (9 PDB entries)

8. Domain d4ho4b1: 4ho4 B:1-296 [234672]
   Other proteins in same PDB: d4ho4b2
   automated match to d4ho9a_
   complexed with g1p, so4, thm

Details for d4ho4b1

PDB Entry: 4ho4, 1.64 Å

PDB Description: crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate

PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4ho4b1:

Sequence; same for both SEQRES and ATOM records:

>d4ho4b1 c.68.1.6 (B:1-296) RmlA (RfbA) {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mkgiilsggsgtrlypltkvvskqllpvydkpmvyyplsvlmlagikdiliistpedtpr
feqllgggselgislsyavqsspdglaqafiigeefigddnvalvlgdnifyghgftell
qraanrksgatifgynvkdpqrfgvvefdekgkvisieekpeepkssyavtglyfydnrv
vdiaknitpsargeleitdvnkaylelgelhvellgrgfawldtgthesllqasqfieti
ekrqslkvacleeiayrmgyisreqliklaeplmkneygqylmnlahrskdlvtve

Timeline for d4ho4b1:

• d4ho4b1 first appeared in SCOPe 2.03, called d4ho4b_
  
• d4ho4b1 appears in SCOPe 2.06
  
• d4ho4b1 appears in the current release, SCOPe 2.08