Lineage for d4ho3a_ (4ho3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1614914Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1614915Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1615076Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 1615095Protein RmlA (RfbA) [53465] (5 species)
  7. 1615096Species Aneurinibacillus thermoaerophilus [TaxId:143495] [228438] (9 PDB entries)
  8. 1615103Domain d4ho3a_: 4ho3 A: [234670]
    automated match to d4ho9a_
    complexed with so4, ttp

Details for d4ho3a_

PDB Entry: 4ho3 (more details), 1.8 Å

PDB Description: crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
PDB Compounds: (A:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4ho3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ho3a_ c.68.1.6 (A:) RmlA (RfbA) {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mkgiilsggsgtrlypltkvvskqllpvydkpmvyyplsvlmlagikdiliistpedtpr
feqllgggselgislsyavqsspdglaqafiigeefigddnvalvlgdnifyghgftell
qraanrksgatifgynvkdpqrfgvvefdekgkvisieekpeepkssyavtglyfydnrv
vdiaknitpsargeleitdvnkaylelgelhvellgrgfawldtgthesllqasqfieti
ekrqslkvacleeiayrmgyisreqliklaeplmkneygqylmnlahr

SCOPe Domain Coordinates for d4ho3a_:

Click to download the PDB-style file with coordinates for d4ho3a_.
(The format of our PDB-style files is described here.)

Timeline for d4ho3a_: