Lineage for d4hind_ (4hin D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579636Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2579637Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2579638Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2579709Protein automated matches [190702] (5 species)
    not a true protein
  7. 2579710Species Cow (Bos taurus) [TaxId:9913] [189730] (4 PDB entries)
  8. 2579722Domain d4hind_: 4hin D: [234654]
    automated match to d4hina_
    complexed with cu, hem

Details for d4hind_

PDB Entry: 4hin (more details), 2.4 Å

PDB Description: 2.4a resolution structure of bovine cytochrome b5 (s71l)
PDB Compounds: (D:) cytochrome b5

SCOPe Domain Sequences for d4hind_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hind_ d.120.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
hstdarellktfiigelhpddr

SCOPe Domain Coordinates for d4hind_:

Click to download the PDB-style file with coordinates for d4hind_.
(The format of our PDB-style files is described here.)

Timeline for d4hind_: