Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [234583] (1 PDB entry) |
Domain d4h0oa1: 4h0o A:2-188 [234584] automated match to d3sk3a1 |
PDB Entry: 4h0o (more details), 2.4 Å
SCOPe Domain Sequences for d4h0oa1:
Sequence, based on SEQRES records: (download)
>d4h0oa1 c.55.1.0 (A:2-188) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} snvlifnvgsssltykvfcsdnivcsgksnrvnvtgtekpfiehhlngqiikietpilnh pqaakliiqflkenhisiafvghrfvhggsyfkksavidevvlkelkeclplapihnpss fgvieismkelpttrqyvaidtafhstisqaertyaipqpyqsqylkfgfhglsyeyvin slknvid
>d4h0oa1 c.55.1.0 (A:2-188) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} snvlifnvgsssltykvfcsdnivcsgksnkpfiehhlngqiikietpilnhpqaaklii qflkenhisiafvghrfvhggsyfkksavidevvlkelkeclplapihnpssfgvieism kelpttrqyvaidtafhstisqaertyaipqpyqsqylkfgfhglsyeyvinslknvid
Timeline for d4h0oa1: