Lineage for d4gy2a1 (4gy2 A:3-209)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441943Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1441944Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1441945Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1442090Protein automated matches [190133] (5 species)
    not a true protein
  7. 1442126Species Clostridium perfringens [TaxId:1502] [234554] (4 PDB entries)
  8. 1442133Domain d4gy2a1: 4gy2 A:3-209 [234555]
    Other proteins in same PDB: d4gy2b1, d4gy2b2
    automated match to d1giqa1
    complexed with atp, ca, lar, po4

Details for d4gy2a1

PDB Entry: 4gy2 (more details), 2.71 Å

PDB Description: Crystal structure of apo-Ia-actin complex
PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d4gy2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gy2a1 d.166.1.1 (A:3-209) automated matches {Clostridium perfringens [TaxId: 1502]}
ierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfydy
qiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfnel
ketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlieqd
ysikidkivriviegkqyikaeasivn

SCOPe Domain Coordinates for d4gy2a1:

Click to download the PDB-style file with coordinates for d4gy2a1.
(The format of our PDB-style files is described here.)

Timeline for d4gy2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gy2a2