Lineage for d1giqa1 (1giq A:3-209)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.166: ADP-ribosylation [56398] (1 superfamily)
unusual foldSuperfamily d.166.1: ADP-ribosylation [56399] (8 families) 
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) 
Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species)
mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component)Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries) 
Domain d1giqa1: 1giq A:3-209 [76224]
complexed with nad
Details for d1giqa1
PDB Entry: 1giq (more details), 1.8 Å
PDB Description: crystal structure of the enzymatic componet of iota-toxin from clostridium perfringens with nadh
PDB Compounds: (A:) Iota toxin component IaSCOPe Domain Sequences for d1giqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1giqa1 d.166.1.1 (A:3-209) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]}
ierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfydy
qiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfnel
ketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlieqd
ysikidkivriviegkqyikaeasivn
SCOPe Domain Coordinates for d1giqa1:
Click to download the PDB-style file with coordinates for d1giqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1giqa1:
- d1giqa1 first appeared in SCOP 1.63
- d1giqa1 appears in SCOPe 2.02
- d1giqa1 appears in SCOPe 2.04
- d1giqa1 appears in the current release, SCOPe 2.08
View in 3D
