SCOPe 2.08: Domain d4gw5a1: 4gw5 A:1-107

Lineage for d4gw5a1 (4gw5 A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Murinae, homo sapiens [TaxId:39107] [228174] (2 PDB entries)

8. Domain d4gw5a1: 4gw5 A:1-107 [234541]
   Other proteins in same PDB: d4gw5a2, d4gw5c2
   automated match to d4gw1c1
   complexed with po4

Details for d4gw5a1

PDB Entry: 4gw5, 2.2 Å

PDB Description: cqyn meditope - cetuximab fab

PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4gw5a1:

Sequence; same for both SEQRES and ATOM records:

>d4gw5a1 b.1.1.0 (A:1-107) automated matches {Murinae, homo sapiens [TaxId: 39107]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk

Timeline for d4gw5a1:

• d4gw5a1 first appeared in SCOPe 2.03
  
• d4gw5a1 appears in SCOPe 2.07