![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Murinae, homo sapiens [TaxId:39107] [228176] (2 PDB entries) |
![]() | Domain d4gw5a2: 4gw5 A:108-212 [234542] Other proteins in same PDB: d4gw5a1, d4gw5b_, d4gw5c1, d4gw5d_ automated match to d4gw1c2 complexed with po4 |
PDB Entry: 4gw5 (more details), 2.2 Å
SCOPe Domain Sequences for d4gw5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gw5a2 b.1.1.2 (A:108-212) automated matches {Murinae, homo sapiens [TaxId: 39107]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4gw5a2:
![]() Domains from other chains: (mouse over for more information) d4gw5b_, d4gw5c1, d4gw5c2, d4gw5d_ |