Lineage for d4gw5a2 (4gw5 A:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753393Species Murinae, homo sapiens [TaxId:39107] [228176] (2 PDB entries)
  8. 2753394Domain d4gw5a2: 4gw5 A:108-212 [234542]
    Other proteins in same PDB: d4gw5a1, d4gw5b_, d4gw5c1, d4gw5d_
    automated match to d4gw1c2
    complexed with po4

Details for d4gw5a2

PDB Entry: 4gw5 (more details), 2.2 Å

PDB Description: cqyn meditope - cetuximab fab
PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4gw5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gw5a2 b.1.1.2 (A:108-212) automated matches {Murinae, homo sapiens [TaxId: 39107]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4gw5a2:

Click to download the PDB-style file with coordinates for d4gw5a2.
(The format of our PDB-style files is described here.)

Timeline for d4gw5a2: