Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
Superfamily c.106.1: SurE-like [64167] (2 families) some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
Family c.106.1.0: automated matches [191430] (1 protein) not a true family |
Protein automated matches [190619] (6 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries) |
Domain d4gada_: 4gad A: [234457] automated match to d2v4na_ complexed with gol, mg; mutant |
PDB Entry: 4gad (more details), 2.35 Å
SCOPe Domain Sequences for d4gada_:
Sequence, based on SEQRES records: (download)
>d4gada_ c.106.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]} masmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfd ngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlg fpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcg srhpadkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvaltaasah dvvsdwldsvgvgt
>d4gada_ c.106.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]} masmrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfd ngdiavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlg fpalavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcg srhadkvipqedprgntlywiggpdtdfaavdegyvsvtplhvaltaasahdvvsdwlds vgvgt
Timeline for d4gada_: