Lineage for d1piv2_ (1piv 2:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163238Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 163239Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 163356Family b.10.1.4: Animal virus proteins [49656] (18 proteins)
  6. 163463Protein Poliovirus [49666] (3 species)
  7. 163502Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)
  8. 163522Domain d1piv2_: 1piv 2: [23436]

Details for d1piv2_

PDB Entry: 1piv (more details), 2.9 Å

PDB Description: binding of the antiviral drug win51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14

SCOP Domain Sequences for d1piv2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1piv2_ b.10.1.4 (2:) Poliovirus {Poliovirus type 3, strain Sabin}
acgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvatcrfyt
ldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgvf
aipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyllgcgvl
lgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaqdssve
ipitvtiapmcsefnglrnvtapkfq

SCOP Domain Coordinates for d1piv2_:

Click to download the PDB-style file with coordinates for d1piv2_.
(The format of our PDB-style files is described here.)

Timeline for d1piv2_: