SCOPe 2.05: Domain d4e16a_: 4e16 A:

Lineage for d4e16a_ (4e16 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.0: automated matches [191315] (1 protein)
   not a true family

6. Protein automated matches [190076] (5 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [234351] (1 PDB entry)

8. Domain d4e16a_: 4e16 A: [234352]
   automated match to d2cbfa_

Details for d4e16a_

PDB Entry: 4e16, 2.49 Å

PDB Description: precorrin-4 c(11)-methyltransferase from clostridium difficile

PDB Compounds: (A:) Precorrin-4 C(11)-methyltransferase

SCOPe Domain Sequences for d4e16a_:

Sequence, based on SEQRES records:

>d4e16a_ c.90.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
mnkvhfvgagpgdkelitlkgykllsnadvviyagslvnpelleyckedcqihnsahmdl
qeiidvmregiennksvvrlqtgdfsiygsireqvedlnklnidydctpgvssflgaass
lgveytvpeisqsviitrmegrtpvpekesiqsyakhqtsmviflsvqeiekvvsklleg
gypkdtpiaviykatwadekivkgtlsdiavkvkenninktalimvgrflge

Sequence, based on observed residues (ATOM records):

>d4e16a_ c.90.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
mnkvhfvgagpgdkelitlkgykllsnadvviyagslvnpelleyckedcqihnsahmdl
qeiidvmregiennksvvrlqtgdfsiygsireqvedlnklnidydctpgvssflgaass
lgveytvpeisqsviitrmtpvpekesiqsyakhqtsmviflsvqeiekvvsklleggyp
kdtpiaviykatwadekivkgtlsdiavkvkenninktalimvgrflge

Timeline for d4e16a_:

• d4e16a_ first appeared in SCOPe 2.03
  
• d4e16a_ appears in SCOPe 2.04
  
• d4e16a_ appears in SCOPe 2.06
  
• d4e16a_ appears in the current release, SCOPe 2.08