Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.0: automated matches [191315] (1 protein) not a true family |
Protein automated matches [190076] (5 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [234351] (1 PDB entry) |
Domain d4e16a_: 4e16 A: [234352] automated match to d2cbfa_ |
PDB Entry: 4e16 (more details), 2.49 Å
SCOPe Domain Sequences for d4e16a_:
Sequence, based on SEQRES records: (download)
>d4e16a_ c.90.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]} mnkvhfvgagpgdkelitlkgykllsnadvviyagslvnpelleyckedcqihnsahmdl qeiidvmregiennksvvrlqtgdfsiygsireqvedlnklnidydctpgvssflgaass lgveytvpeisqsviitrmegrtpvpekesiqsyakhqtsmviflsvqeiekvvsklleg gypkdtpiaviykatwadekivkgtlsdiavkvkenninktalimvgrflge
>d4e16a_ c.90.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]} mnkvhfvgagpgdkelitlkgykllsnadvviyagslvnpelleyckedcqihnsahmdl qeiidvmregiennksvvrlqtgdfsiygsireqvedlnklnidydctpgvssflgaass lgveytvpeisqsviitrmtpvpekesiqsyakhqtsmviflsvqeiekvvsklleggyp kdtpiaviykatwadekivkgtlsdiavkvkenninktalimvgrflge
Timeline for d4e16a_: