Lineage for d4e16a_ (4e16 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142835Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2142836Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2143052Family c.90.1.0: automated matches [191315] (1 protein)
    not a true family
  6. 2143053Protein automated matches [190076] (5 species)
    not a true protein
  7. 2143054Species Clostridium difficile [TaxId:272563] [234351] (1 PDB entry)
  8. 2143055Domain d4e16a_: 4e16 A: [234352]
    automated match to d2cbfa_

Details for d4e16a_

PDB Entry: 4e16 (more details), 2.49 Å

PDB Description: precorrin-4 c(11)-methyltransferase from clostridium difficile
PDB Compounds: (A:) Precorrin-4 C(11)-methyltransferase

SCOPe Domain Sequences for d4e16a_:

Sequence, based on SEQRES records: (download)

>d4e16a_ c.90.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
mnkvhfvgagpgdkelitlkgykllsnadvviyagslvnpelleyckedcqihnsahmdl
qeiidvmregiennksvvrlqtgdfsiygsireqvedlnklnidydctpgvssflgaass
lgveytvpeisqsviitrmegrtpvpekesiqsyakhqtsmviflsvqeiekvvsklleg
gypkdtpiaviykatwadekivkgtlsdiavkvkenninktalimvgrflge

Sequence, based on observed residues (ATOM records): (download)

>d4e16a_ c.90.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
mnkvhfvgagpgdkelitlkgykllsnadvviyagslvnpelleyckedcqihnsahmdl
qeiidvmregiennksvvrlqtgdfsiygsireqvedlnklnidydctpgvssflgaass
lgveytvpeisqsviitrmtpvpekesiqsyakhqtsmviflsvqeiekvvsklleggyp
kdtpiaviykatwadekivkgtlsdiavkvkenninktalimvgrflge

SCOPe Domain Coordinates for d4e16a_:

Click to download the PDB-style file with coordinates for d4e16a_.
(The format of our PDB-style files is described here.)

Timeline for d4e16a_: