Lineage for d4bs0b_ (4bs0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831376Species Thermoascus aurantiacus [TaxId:5087] [190006] (28 PDB entries)
  8. 2831379Domain d4bs0b_: 4bs0 B: [234278]
    automated match to d4bs0a_
    complexed with 6nt, so4

Details for d4bs0b_

PDB Entry: 4bs0 (more details), 1.09 Å

PDB Description: Crystal Structure of Kemp Eliminase HG3.17 E47N,N300D Complexed with Transition State Analog 6-Nitrobenzotriazole
PDB Compounds: (B:) kemp eliminase hg3.17

SCOPe Domain Sequences for d4bs0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bs0b_ c.1.8.3 (B:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
qsidqlikargkvyfgvatdqnrlttgknaaiikadfgmvwpensmqwdatepsqgnfnf
agadylvnwaqqngkligagclvwhnflpswvssitdkntlinvmknhittlmtrykgki
rtwdvvgeafnedgslrqnvflnvigedyipiafqtaraadpnaklyimdynldsasypk
tqaivnrvkqwraagvpidgigsqmhlsagqgagvlqalpllasagtpevsilmldvaga
sptdyvnvvnaclnvqscvgitvmgvadpdsafasstpllfdgnfnpkpaynaivqdlqq

SCOPe Domain Coordinates for d4bs0b_:

Click to download the PDB-style file with coordinates for d4bs0b_.
(The format of our PDB-style files is described here.)

Timeline for d4bs0b_: