SCOPe 2.03: Domain d4bs0b_: 4bs0 B:

Lineage for d4bs0b_ (4bs0 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (15 species)
   not a true protein

7. Species Thermoascus aurantiacus [TaxId:5087] [190006] (3 PDB entries)

8. Domain d4bs0b_: 4bs0 B: [234278]
   automated match to d4bs0a_
   complexed with 6nt, so4

Details for d4bs0b_

PDB Entry: 4bs0, 1.09 Å

PDB Description: Crystal Structure of Kemp Eliminase HG3.17 E47N,N300D Complexed with Transition State Analog 6-Nitrobenzotriazole

PDB Compounds: (B:) kemp eliminase hg3.17

SCOPe Domain Sequences for d4bs0b_:

Sequence; same for both SEQRES and ATOM records:

>d4bs0b_ c.1.8.3 (B:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
qsidqlikargkvyfgvatdqnrlttgknaaiikadfgmvwpensmqwdatepsqgnfnf
agadylvnwaqqngkligagclvwhnflpswvssitdkntlinvmknhittlmtrykgki
rtwdvvgeafnedgslrqnvflnvigedyipiafqtaraadpnaklyimdynldsasypk
tqaivnrvkqwraagvpidgigsqmhlsagqgagvlqalpllasagtpevsilmldvaga
sptdyvnvvnaclnvqscvgitvmgvadpdsafasstpllfdgnfnpkpaynaivqdlqq

Timeline for d4bs0b_:

• d4bs0b_ is new in SCOPe 2.03-stable
  
• d4bs0b_ appears in SCOPe 2.04
  
• d4bs0b_ appears in the current release, SCOPe 2.08