Lineage for d4bbhb1 (4bbh B:27-210)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575843Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. 2575851Domain d4bbhb1: 4bbh B:27-210 [234135]
    automated match to d1iica1
    complexed with cl, dms, mg, nhw, so4, ybn

Details for d4bbhb1

PDB Entry: 4bbh (more details), 1.63 Å

PDB Description: Plasmodium vivax N-myristoyltransferase with a bound benzothiophene inhibitor
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4bbhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bbhb1 d.108.1.0 (B:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d4bbhb1:

Click to download the PDB-style file with coordinates for d4bbhb1.
(The format of our PDB-style files is described here.)

Timeline for d4bbhb1: