Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) |
Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
Protein automated matches [195455] (14 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [234123] (1 PDB entry) |
Domain d4b5ca_: 4b5c A: [234124] automated match to d4g4va_ complexed with act |
PDB Entry: 4b5c (more details), 2.3 Å
SCOPe Domain Sequences for d4b5ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b5ca_ d.79.7.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} dplndpnsplakrsvyfdfdsysvqdqyqallqqhaqylkshpqrhiliqgntdergtse ynlalgqkraeavrralsllgvgdaqmeavslgkekpvalghdeaswaqnrradlvyqq
Timeline for d4b5ca_: