SCOPe 2.04: Domain d4az8a2: 4az8 A:148-234

Lineage for d4az8a2 (4az8 A:148-234)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.0: automated matches [227280] (1 protein)
   not a true family

6. Protein automated matches [227091] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226477] (3 PDB entries)

8. Domain d4az8a2: 4az8 A:148-234 [234116]
   Other proteins in same PDB: d4az8a1, d4az8b_
   automated match to d3dosa2

Details for d4az8a2

PDB Entry: 4az8, 2.65 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4az8a2:

Sequence, based on SEQRES records:

>d4az8a2 b.7.2.0 (A:148-234) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvt

Sequence, based on observed residues (ATOM records):

>d4az8a2 b.7.2.0 (A:148-234) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdkliaenpspfymnigeltfggksipshyippkstwafdlpagar
nvswriindqggldrlysknvt

Timeline for d4az8a2:

• d4az8a2 first appeared in SCOPe 2.03
  
• d4az8a2 appears in SCOPe 2.05
  
• d4az8a2 appears in the current release, SCOPe 2.08