SCOPe 2.07: Domain d4au8a1: 4au8 A:2-289

Lineage for d4au8a1 (4au8 A:2-289)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)

8. Domain d4au8a1: 4au8 A:2-289 [234098]
   Other proteins in same PDB: d4au8a2
   automated match to d4au8b_
   complexed with imd, so4, z3r

Details for d4au8a1

PDB Entry: 4au8, 1.9 Å

PDB Description: Crystal structure of compound 4a in complex with cdk5, showing an unusual binding mode to the hinge region via a water molecule

PDB Compounds: (A:) cyclin-dependent kinase 5

SCOPe Domain Sequences for d4au8a1:

Sequence, based on SEQRES records:

>d4au8a1 d.144.1.7 (A:2-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhk
nivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrn
vlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklyst
sidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypm
ypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdf

Sequence, based on observed residues (ATOM records):

>d4au8a1 d.144.1.7 (A:2-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkyeklekigegtygtvfkaknretheivalkrvpssalreicllkelkhknivrlhdvl
hkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqnll
inrngelkladfglarafgipvrsaevvtlwyrppdvlfgaklystsidmwsagcifael
anagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnvvpkl
natgrdllqnllkcnpvqrisaeealqhpyfsdf

Timeline for d4au8a1:

• d4au8a1 first appeared in SCOPe 2.03, called d4au8a_
  
• d4au8a1 appears in SCOPe 2.06
  
• d4au8a1 appears in the current release, SCOPe 2.08