SCOPe 2.07: Domain d4anea_: 4ane A:

Lineage for d4anea_ (4ane A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries)

8. Domain d4anea_: 4ane A: [234079]
   automated match to d3fc9a_
   complexed with cit; mutant

Details for d4anea_

PDB Entry: 4ane, 1.9 Å

PDB Description: r80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4anea_:

Sequence; same for both SEQRES and ATOM records:

>d4anea_ d.58.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

Timeline for d4anea_:

• d4anea_ first appeared in SCOPe 2.03
  
• d4anea_ appears in SCOPe 2.06
  
• d4anea_ appears in the current release, SCOPe 2.08