Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (45 species) not a true protein |
Domain d3vc5a2: 3vc5 A:134-419 [233844] Other proteins in same PDB: d3vc5a1 automated match to d4it1d2 |
PDB Entry: 3vc5 (more details), 1.5 Å
SCOPe Domain Sequences for d3vc5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vc5a2 c.1.11.0 (A:134-419) automated matches {Thermobispora bispora [TaxId: 469371]} gkvrdavpysaylfykwaghpgkpedrfgpaldpdgivaqarlligeygfrsiklkggvf ppeqeaeaiqalrdafpglplrldpnaawtvetsirvgraldgvleyledptpgidgmar vaaevpmplatnmcvvtpehlpaaverrpigvllidhhywgglvrsahiatlcatfgiel smhsnshlgislaamthlaaatpaithacdthtpwqdgqdvvapgalrfvdgavpvpdgp glgveldrdalavmheqyercgirtrddegymrsfdpsfstrrgfw
Timeline for d3vc5a2: