Lineage for d3vc5a2 (3vc5 A:134-419)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837825Species Thermobispora bispora [TaxId:469371] [233843] (3 PDB entries)
  8. 2837830Domain d3vc5a2: 3vc5 A:134-419 [233844]
    Other proteins in same PDB: d3vc5a1
    automated match to d4it1d2
    complexed with po4

Details for d3vc5a2

PDB Entry: 3vc5 (more details), 1.5 Å

PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with phosphate
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3vc5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vc5a2 c.1.11.0 (A:134-419) automated matches {Thermobispora bispora [TaxId: 469371]}
gkvrdavpysaylfykwaghpgkpedrfgpaldpdgivaqarlligeygfrsiklkggvf
ppeqeaeaiqalrdafpglplrldpnaawtvetsirvgraldgvleyledptpgidgmar
vaaevpmplatnmcvvtpehlpaaverrpigvllidhhywgglvrsahiatlcatfgiel
smhsnshlgislaamthlaaatpaithacdthtpwqdgqdvvapgalrfvdgavpvpdgp
glgveldrdalavmheqyercgirtrddegymrsfdpsfstrrgfw

SCOPe Domain Coordinates for d3vc5a2:

Click to download the PDB-style file with coordinates for d3vc5a2.
(The format of our PDB-style files is described here.)

Timeline for d3vc5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vc5a1