Lineage for d3v1oa_ (3v1o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887531Species Xenotropic mulv-related virus vp35 [TaxId:356663] [226326] (3 PDB entries)
  8. 2887532Domain d3v1oa_: 3v1o A: [233825]
    automated match to d4e89a_
    complexed with gol, mrd, so4

Details for d3v1oa_

PDB Entry: 3v1o (more details), 1.88 Å

PDB Description: Crystal structures of the reverse transcriptase-associated ribonuclease H domain of xenotropic murine leukemia-virus related virus
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H p80

SCOPe Domain Sequences for d3v1oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v1oa_ c.55.3.0 (A:) automated matches {Xenotropic mulv-related virus vp35 [TaxId: 356663]}
hgtrpdltdqpipdadytwytdgssflqegqrragaavtteteviwaralpagtsaqrae
lialtqalkmaegkklnvytdsryafatahvhgeiyrrrglltsegreiknkneilallk
alflpkrlsiihcpghqkgnsaeargnrmadqaareaamkavlet

SCOPe Domain Coordinates for d3v1oa_:

Click to download the PDB-style file with coordinates for d3v1oa_.
(The format of our PDB-style files is described here.)

Timeline for d3v1oa_: