Lineage for d3ttvb2 (3ttv B:598-753)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589536Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1589537Protein automated matches [190197] (15 species)
    not a true protein
  7. 1589634Species Escherichia coli [TaxId:562] [186939] (6 PDB entries)
  8. 1589637Domain d3ttvb2: 3ttv B:598-753 [233736]
    Other proteins in same PDB: d3ttva1, d3ttvb1, d3ttvc1, d3ttvd1
    automated match to d1p80a1
    complexed with hem

Details for d3ttvb2

PDB Entry: 3ttv (more details), 1.45 Å

PDB Description: Structure of the F413E variant of E. coli KatE
PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d3ttvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttvb2 c.23.16.0 (B:598-753) automated matches {Escherichia coli [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3ttvb2:

Click to download the PDB-style file with coordinates for d3ttvb2.
(The format of our PDB-style files is described here.)

Timeline for d3ttvb2: