Lineage for d3tttd2 (3ttt D:598-753)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840750Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1840751Protein automated matches [190197] (18 species)
    not a true protein
  7. 1840843Species Escherichia coli [TaxId:562] [186939] (6 PDB entries)
  8. 1840852Domain d3tttd2: 3ttt D:598-753 [233726]
    Other proteins in same PDB: d3ttta1, d3tttb1, d3tttc1, d3tttd1
    automated match to d1p80a1
    complexed with hem

Details for d3tttd2

PDB Entry: 3ttt (more details), 1.58 Å

PDB Description: Structure of F413Y variant of E. coli KatE
PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d3tttd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tttd2 c.23.16.0 (D:598-753) automated matches {Escherichia coli [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3tttd2:

Click to download the PDB-style file with coordinates for d3tttd2.
(The format of our PDB-style files is described here.)

Timeline for d3tttd2: