SCOPe 2.05: Domain d3tttc2: 3ttt C:598-753

Lineage for d3tttc2 (3ttt C:598-753)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186939] (6 PDB entries)

8. Domain d3tttc2: 3ttt C:598-753 [233724]
   Other proteins in same PDB: d3ttta1, d3tttb1, d3tttc1, d3tttd1
   automated match to d1p80a1
   complexed with hem

Details for d3tttc2

PDB Entry: 3ttt, 1.58 Å

PDB Description: Structure of F413Y variant of E. coli KatE

PDB Compounds: (C:) catalase hpii

SCOPe Domain Sequences for d3tttc2:

Sequence; same for both SEQRES and ATOM records:

>d3tttc2 c.23.16.0 (C:598-753) automated matches {Escherichia coli [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d3tttc2:

• d3tttc2 first appeared in SCOPe 2.03
  
• d3tttc2 appears in SCOPe 2.04
  
• d3tttc2 appears in SCOPe 2.06
  
• d3tttc2 appears in the current release, SCOPe 2.08