Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Bradyrhizobium sp. [TaxId:114615] [233701] (2 PDB entries) |
Domain d3toyd2: 3toy D:133-360 [233703] Other proteins in same PDB: d3toya1, d3toyb1, d3toyc1, d3toyd1 automated match to d4hncb2 complexed with act, ca, ni, p4c |
PDB Entry: 3toy (more details), 1.8 Å
SCOPe Domain Sequences for d3toyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3toyd2 c.1.11.0 (D:133-360) automated matches {Bradyrhizobium sp. [TaxId: 114615]} pipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamikglrallgpdia lmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerseipiqagenwwf prgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilpeasahvlpvtp tahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt
Timeline for d3toyd2: