Lineage for d3toyd2 (3toy D:133-360)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1573922Species Bradyrhizobium sp. [TaxId:114615] [233701] (2 PDB entries)
  8. 1573926Domain d3toyd2: 3toy D:133-360 [233703]
    Other proteins in same PDB: d3toya1, d3toyb1, d3toyc1, d3toyd1
    automated match to d4hncb2
    complexed with act, ca, ni, p4c

Details for d3toyd2

PDB Entry: 3toy (more details), 1.8 Å

PDB Description: crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. ors278 with calcium and acetate bound
PDB Compounds: (D:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d3toyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3toyd2 c.1.11.0 (D:133-360) automated matches {Bradyrhizobium sp. [TaxId: 114615]}
pipaydsygvldarddertlrtacdehgfraikskgghgdlatdeamikglrallgpdia
lmldfnqsldpaeatrriarladydltwieepvpqenlsghaavrerseipiqagenwwf
prgfaeaiaagasdfimpdlmkvggitgwlnvagqadaasipmsshilpeasahvlpvtp
tahflevldfagailteplrvidgkvtakgpglglawnesavakyqvt

SCOPe Domain Coordinates for d3toyd2:

Click to download the PDB-style file with coordinates for d3toyd2.
(The format of our PDB-style files is described here.)

Timeline for d3toyd2: