Lineage for d3tnya_ (3tny A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2520116Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2520117Protein automated matches [190944] (40 species)
    not a true protein
  7. 2520126Species Bacillus cereus [TaxId:1396] [233693] (1 PDB entry)
  8. 2520127Domain d3tnya_: 3tny A: [233694]
    automated match to d3tefa_
    complexed with skz

Details for d3tnya_

PDB Entry: 3tny (more details), 1.55 Å

PDB Description: structure of yfiy from bacillus cereus bound to the siderophore iron (iii) schizokinen
PDB Compounds: (A:) YfiY (ABC transport system substrate-binding protein)

SCOPe Domain Sequences for d3tnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnya_ c.92.2.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
evvtvehamgktevpanpkrvviltnegteallelgvkpvgavkswtgdpwyphikdkmk
dvkvvgdegqvnvetiaslkpdliignkmrhekvyeqlkaiaptvfsetlrgewkdnfkf
yakalnkekegqkvvadyesrmkdlkgklgdkvnqeismvrfmpgdvriyhgdtfsgvil
kelgfkrpgdqnkddfaernvskerisamdgdvlfyftfdkgnekkgselekeyindplf
knlnavkngkaykvddviwntaggviaanlllddiekrfv

SCOPe Domain Coordinates for d3tnya_:

Click to download the PDB-style file with coordinates for d3tnya_.
(The format of our PDB-style files is described here.)

Timeline for d3tnya_: