Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [226972] (9 species) not a true protein |
Species Geobacillus sp. [TaxId:129337] [233671] (4 PDB entries) |
Domain d3taqa2: 3taq A:469-876 [233676] Other proteins in same PDB: d3taqa1 automated match to d2hhva2 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 3taq (more details), 1.65 Å
SCOPe Domain Sequences for d3taqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3taqa2 e.8.1.1 (A:469-876) automated matches {Geobacillus sp. [TaxId: 129337]} eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
Timeline for d3taqa2: