Lineage for d3taqa1 (3taq A:297-468)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887276Species Geobacillus sp. [TaxId:129337] [233669] (4 PDB entries)
  8. 2887279Domain d3taqa1: 3taq A:297-468 [233675]
    Other proteins in same PDB: d3taqa2
    automated match to d1nk4a1
    protein/DNA complex; complexed with mg, so4

Details for d3taqa1

PDB Entry: 3taq (more details), 1.65 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-4) position
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d3taqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3taqa1 c.55.3.0 (A:297-468) automated matches {Geobacillus sp. [TaxId: 129337]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d3taqa1:

Click to download the PDB-style file with coordinates for d3taqa1.
(The format of our PDB-style files is described here.)

Timeline for d3taqa1: