Lineage for d3t62d_ (3t62 D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637462Protein automated matches [190046] (3 species)
    not a true protein
  7. 2637525Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (4 PDB entries)
  8. 2637527Domain d3t62d_: 3t62 D: [233668]
    Other proteins in same PDB: d3t62a_, d3t62b_, d3t62c_
    automated match to d3m7qb_
    complexed with so4

Details for d3t62d_

PDB Entry: 3t62 (more details), 2 Å

PDB Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean Sea anemone Stichodactyla helianthus in complex with bovine chymotrypsin
PDB Compounds: (D:) Kunitz-type proteinase inhibitor SHPI-1

SCOPe Domain Sequences for d3t62d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t62d_ g.8.1.1 (D:) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr

SCOPe Domain Coordinates for d3t62d_:

Click to download the PDB-style file with coordinates for d3t62d_.
(The format of our PDB-style files is described here.)

Timeline for d3t62d_: